|
Post by kammy4 on May 18, 2013 6:42:04 GMT -5
Hey All, I'm not in here too much, I've had a rough winter with my health declining. The sun just came out today the longest, darkest winter here. I got pneumonia this winter and still think I have a 'walking' version of it, another infection that after shots and many rounds of antibiotics, my immune system has to be shot. I'm not into researching right now, so I will speak entirely 'layman': In a nutshell - those with psorrias lesions - somehow the 'thing' that controls how our skin cells multiply has been sent out of control to multiply wildly to cause patches to build up on the skin. These patches are thick and hard and create some sort of a biofilm barrier that is hard to penetrate. It goes through a cycle in this build up process to where it sluffs at the end of the cycle to take you back to your red scalded-looking 'skin' but sometimes looks 'normal', then starts its cycle of building up over and over. (It's like a bad case of white spot fish disease. Ich... yes, probably a mixture that we'll never know the true ingredients of - plant, insect, animal, bacterial, fungal, viral - who knows? A PacMan dot eater that picks up and eventually incorporates whatever comes around. So, I can have "this" and you can have "that" mixture or alteration so that our symptoms are not exactly the same. We all sluff skin cells, (whatever that cycle is?) when this disease accelerates or if one has a more severe case - you will see these white specks on your car's dashboard especially or where you sit most of the time if you're on the right kind of furniture to see these particles. (I call it the 'particle physics' disease, I also call it 'anti-socialism' as a form of governing.) Doctors simply see us as people with "skin conditions", since our conditions aren't life threatening; how we are being slow killed... well, 2 and 2 are not being put together. I see Don's thread on 'I think I can cure...' - looks interesting...
|
|
|
Post by kritters on May 19, 2013 8:16:01 GMT -5
Thanks for this, Kam!
Sorry to hear your health isn't good, my friend. This is bad news. The weather here sucks as well. The chemtrails are turning a potentially beautiful, sunny day into nothing but clouds and wind daily.
I hope you are taking a good Vit D supplement and/or getting to a tanning booth at least.
Be well, Kam
xoKritts
|
|
|
Post by kritters on May 20, 2013 20:33:35 GMT -5
Biomedical research [edit] Chitin may be employed for affinity purification of recombinant protein. A chitin binding domain is genetically fused to a protein of interest and then contacted to beads coated with chitin. The immobilized protein is purified and released from the beads by cleaving off the chitin binding domain.[clarification needed][citation needed]
so what happens to the chitin bound protein when it's 'cleaved' into our systems?
|
|
|
Post by kritters on May 20, 2013 20:35:58 GMT -5
;D I really never realized how pervasive chitin actually is in our every day, whether in nature or created in labs, recombinant with PROTEINS.
They have no idea what havoc they are wreaking with society by fooling around with this stuff.
so disgusting.
Kritts
|
|
|
Post by kritters on Jun 1, 2013 17:10:50 GMT -5
Hey guys,
I pulled a tick out of someone and need to know where to send it for testing for Lyme.
Anyone know of a reputable lab?
Kritts
|
|
|
Post by skyship on Jun 1, 2013 18:04:59 GMT -5
There is one in Palo Alto, Ca and one in Fl. www.igenex.com/Website/Laboratories That Will Test Ticks From The General Public Several laboratories test ticks for pathogens, including Borrelia burgdorferi, the pathogen that causes Lyme disease. Some of these are listed below, along with contact information. They may vary widely in price, response time, and proper procedures for mailing. This listing is for your convenience only, and is not comprehensive. Inclusion on this list does not constitute endorsement by TCHD or NYSDOH. In Addition, please realize that any laboratory test may result in false positives or false negatives. And a tick testing positive for a particular pathogen does not mean that the individual or animal that was bitten is positive for the disease that pathogen causes. Disease transmission is dependent on many variables, including duration of attachment, species and life stage of tick, and immunological characteristics. Analytical Services, Inc. Attn: Tick Testing 130 Allen Brook Lane Williston, VT 05495 (800) 723-4432 tick@analyticalservices.com Info: Cost $65 per tick Imugen, Inc Attn: Tick Testing 220 Norwood Park South Norwood, MA 02062 (781) 255-0770 Info: Cost $75 per tick $ 98 per tick for Lyme and Babesia testing Laboratories That Will Test Ticks From The General Public ** www.tompkins-co.org/health/summer/Tick-Testing.pdf - Proxy - Highlight Laboratories That Will Test Ticks From The General Public ... Cost $64 per tick for Lyme testing ... Send via USPS or other courier
|
|
|
Post by skyship on Jun 3, 2013 15:49:13 GMT -5
Krits,
Darn good capture, my friend.
And........you question about Candida is being looked at on a deeper level.
So, if aliens are created in the LAB......well.....those ticks could carry any of those forms, along with those tricky little carbon buckballs in side the formation of the tubers.........But the tubers can look like hyphae........... the Spitzenkorper............mmmmmmm what makes the hyphae move.........
mmmmmmmmmm Well more digging my friend, we are looking into better discussion of this thing, which could have been delivered first by release of their favorite diptera, gnat and tick and now the reduviid bugs are running rampart all over the states, delivering the New American Chagas.
These Chagas forms could have been engineered in the New Biology Alien Labs at UCLA, it seems there are some signatures from NASA to make it look like it came from outer space, great cover for the crooks in the LABs.......this is not real science, this is "covert operations" in my opinion.
|
|
|
Post by kritters on Jun 4, 2013 18:26:43 GMT -5
do not like this new format that is all of a sudden replacing the other more comfortable one. No improvement. :-( very difficult to maneuver.
|
|
|
Post by skyship on Jun 4, 2013 18:34:45 GMT -5
Very slow too. Looks like the bosses came in and changed all formats in all forums.
Proboards is updating to mobiles, facebook, iphone, etc.
Will we have phone, computer and tv all together now? for everyone, no exceptions?
All controlled by smart grid, tesla and smart dust, smart meters, smart devices, smart wireless, smart genomes, smart robots, all by so-alled "smart arses"......
Well, laa...dee....dah.......... for the convergence of the singularity.
|
|
|
Post by kritters on Jun 12, 2013 20:06:22 GMT -5
I know I'm dense, but I used to be able to see the newest posts/threads each time I logged in. Don't know how to do this now.
|
|
|
Post by kammy4 on Jun 18, 2013 6:59:26 GMT -5
Hi Gals, I just don't have much interest in anything anymore. It seems that whatever the creation is that has gotten inside of us is not going to be easy to destroy to get our health back but that the key lies somewhere in: en.wikipedia.org/wiki/Plasma_membraneThat the vesicle membrane has to respond to something to cause apoptosis? Anyway, got to start at the beginning to get to the end. If anyone has the gumption to look closer... Sorry to hear about Ivanhoe, (sad) I see Skizit is touting Raspberry Ultra Drops? Is she trying to tell us something?
|
|
|
Post by kritters on Jun 18, 2013 14:43:00 GMT -5
Hey Kam!
Funny you should mention that. I was just reading something about candida causing thyroid problems and there is something they suggest taking that breaks the plasma membrane of the candida. Or was is chitin, which it might be composed of? I'll have to look for it.
Kath
|
|
|
Post by kritters on Jun 18, 2013 19:04:32 GMT -5
Here's another Kritters' random thought. It would be great if we were notified of any comments to our posts or messages.
|
|
|
Post by skyship on Jun 23, 2013 19:43:10 GMT -5
Kammy,
Hello there, our friend. On your link one sentence from the info struck at me~! BAM from Kam~!
" Cell membranes are involved in a variety of cellular processes such as cell adhesion, ion conductivity and cell signaling and serve as the attachment surface for several extracellular structures, including the cell wall, glycocalyx, and intracellular cytoskeleton. Cell membranes can be artificially reassembled.[3][4][5].......
those references 3, 4, and 5. mmmmm might help us.
3. ^ Budin, Itay; Devaraj, Neal K. (December 29, 2011). "Membrane Assembly Driven by a Biomimetic Coupling Reaction". Journal of the American Chemical Society. 134 (2): 751–753. doi:10.1021/ja2076873. Retrieved February 18, 2012. 4. ^ Staff (January 25, 2012). "Chemists Synthesize Artificial Cell Membrane". ScienceDaily. Retrieved February 18, 2012. 5. ^ Staff (January 26, 2012). "Chemists create artificial cell membrane". kurzweilai.net. Retrieved February 18, 2012.
|
|
|
Post by skyship on Jun 23, 2013 19:54:06 GMT -5
3. One of the major goals of synthetic biology is the development of non-natural cellular systems. In this work, we describe a catalytic biomimetic coupling reaction capable of driving the de novo self-assembly of phospholipid membranes. Our system features a coppercatalyzed azide–alkyne cycloaddition that results in the formation of a triazole-containing phospholipid analogue. Concomitant assembly of membranes occurs spontaneously, not requiring preexisting membranes to house catalysts or precursors. The substitution of efficient synthetic reactions for key biochemical processes may offer a general route toward synthetic biological systems. pubs.acs.org/doi/abs/10.1021/ja2076873going further into the synthetic: Chemists Synthesize Artificial Cell Membrane Jan. 26, 2012 — Chemists have taken an important step in making artificial life forms from scratch. Using a novel chemical reaction, they have created self-assembling cell membranes, the structural envelopes that contain and support the reactions required for life.... ""We don't understand this really fundamental step in our existence, which is how non-living matter went to living matter," Devaraj said. "So this is a really ripe area to try to understand what knowledge we lack about how that transition might have occurred. That could teach us a lot -- even the basic chemical, biological principles that are necessary for life."
Molecules that make up cell membranes have heads that mix easily with water and tails that repel it. In water, they form a double layer with heads out and tails in, a barrier that sequesters the contents of the cell.
Devaraj and Budin created similar molecules with a novel reaction that joins two chains of lipids. Nature uses complex enzymes that are themselves embedded in membranes to accomplish this, making it hard to understand how the very first membranes came to be.
"In our system, we use a sort of primitive catalyst, a very simple metal ion," Devaraj said. "The reaction itself is completely artificial. There's no biological equivalent of this chemical reaction. This is how you could have a de novo formation of membranes."
They created the synthetic membranes from a watery emulsion of an oil and a detergent. Alone it's stable. Add copper ions and sturdy vesicles and tubules begin to bud off the oil droplets. After 24 hours, the oil droplets are gone, "consumed" by the self-assembling membranes.www.sciencedaily.com/releases/2012/01/120125132822.htmComplex cell membrane showing phospholipid membrane (credit: NIST) www.kurzweilai.net/chemists-create-artificial-cell-membrane
|
|
|
Post by skyship on Jun 23, 2013 20:02:26 GMT -5
so the coil is hydrophobic( water hating) while the rest of the helix is hydro philic (fungal like with hyphae) in extracellular matrix fluid.
So these forms can coil like worms, while both ends of the "alpha helix", meaning beginning form (ai) can branch.
but this is all the same helical strand. And.........the phospholipids (like fatty acids helps the coil repel water) like an oil droplet.
The coil seems to be an anchor in the phospholipds.
So what is this artificial "alpha helix Protein"?
Oh. and the side chains that branch are oligosaccharides.
|
|
|
Post by skyship on Jun 25, 2013 14:22:08 GMT -5
|
|
|
Post by skyship on Jun 25, 2013 14:28:06 GMT -5
From the Patent: "Claims: 1. A method for the generation of a protein selected from the group consisting of proteins of the protein superfamily of "ubiquitin-like proteins", as well as fragments or fusion proteins thereof, each of which having the ubiquitin-like folding motif, wherein the protein due to one or more modifications of amino acids in the alpha helical region shows an improved binding affinity with respect to an agent which binding affinity did not exist or did not exist to that extent in the unmodified protein, with the following steps:a) selecting an unmodified protein of the superfamily of "ubiquitin-like proteins";b) providing an agent to which the unmodified protein has low or no binding affinity;c) selecting amino acids in a surface-exposed region of the protein including the alpha helical region;d) modifying the selected amino acids, wherein at least four surface-exposed amino acids in the alpha helix or adjacent regions are modified;e) contacting the modified protein with the agent provided in step b);f) detecting and isolating the protein having a new or enhanced binding affinity with respect to the agent provided in step b), and optionally the following steps:g) producing the modified protein in a suitable prokaryotic, eukaryotic or in vitro expression system, or by chemical synthesis;h) isolating the proteins after production by a suitable purification method; and further optionallyi) performing a maturation of the modified protein by repeating the steps d-h). Read more: www.faqs.org/patents/app/20100130720#ixzz2XG3EhrPz
|
|
|
Post by skyship on Jun 25, 2013 14:35:53 GMT -5
Selecting unmodified proteins of the superfamily of "ubiquitin-like proteins" This was released this Jan 2013. scop.berkeley.edu/sunid=69572What can we learn? We are dealing with enzymes: Whatever this means? "Superfamily: c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S) transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds" scop.berkeley.edu/sunid=69571============ Activating enzymes of the ubiquitin-like proteins [69572] (3 families) ==== Here is the Root of the Alpha: Classes in SCOP 1.75: a: All alpha proteins [46456] (284 folds) b: All beta proteins [48724] (174 folds) c: Alpha and beta proteins (a/b) [51349] (147 folds) d: Alpha and beta proteins (a+b) [53931] (376 folds) e: Multi-domain proteins (alpha and beta) [56572] (66 folds) f: Membrane and cell surface proteins and peptides [56835] (58 folds) g: Small proteins [56992] (90 folds) h: Coiled coil proteins [57942] (7 folds) i: Low resolution protein structures [58117] (26 folds) j: Peptides [58231] (121 folds) k: Designed proteins [58788] (44 folds) scop.berkeley.edu/sunid=0&ver=1.75These can be clicked on for further identification: =======================
|
|
|
Post by skyship on Jun 25, 2013 14:37:34 GMT -5
|
|
|
Post by skyship on Jun 25, 2013 14:38:52 GMT -5
|
|
|
Post by skyship on Jun 25, 2013 14:40:13 GMT -5
|
|
|
Post by skyship on Jun 25, 2013 14:45:25 GMT -5
Prions act like viruses. Superfamilies: Superfamilies: h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S) h.3.2: Virus ectodomain [58069] (1 family) (S) h.3.3: Coronavirus S2 glycoprotein [111474] (1 family) (S) scop.berkeley.edu/sunid=58063&ver=1.73========== Lets look at virus ectodomain (1family) Family: h.3.2.1: Virus ectodomain [58070] (8 protein domains) ============ Protein Domains: Core structure of Ebo gp2 [58076] (1 species) Species Ebola virus [TaxId:205488] [58077] (2 PDB entries) HERV-FRD_6p24.1 provirus ancestral Env polyprotein [144288] (1 species) Species Human (Homo sapiens) [TaxId:9606] [144289] (1 PDB entry) HRSV fusion protein core [58080] (1 species) Species Human respiratory syncytial virus [TaxId:11250] [58081] (1 PDB entry) HTLV-1 gp21 [58074] (1 species) Species Human T-cell leukemia virus type 1 [TaxId:11908] [58075] (1 PDB entry) MoMLV p15 core fragment [58627] (1 species) Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [58628] (1 PDB entry) Paramyxovirus sv5 fusion protein core [58078] (1 species) trimer of heterodimers Species Simian virus 5, strain w3 [TaxId:11207] [58079] (1 PDB entry) Retrovius gp41 protease-resistant core [58071] (3 species) coiled coil; biological unit: trimer Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (19 PDB entries) Species Simian immunodeficiency virus [TaxId:11723] [58073] (10 PDB entries) Species Visna virus [TaxId:11741] [64597] (1 PDB entry) Stalk of the ectodomain of NDV fusion glycoprotein [69983] (1 species) Species Newcastle disease virus [TaxId:11176] [69984] (1 PDB entry) More info for Family h.3.2.1: Virus ectodomain Timeline for Family h.3.2.1: Virus ectodomain: Family h.3.2.1: Virus ectodomain appears in SCOP 1.71 Family h.3.2.1: Virus ectodomain appears in SCOP 1.75 scop.berkeley.edu/sunid=58070&ver=1.73next: Core structure
|
|
|
Post by skyship on Jun 25, 2013 14:47:38 GMT -5
|
|
|
Post by skyship on Jun 25, 2013 17:01:05 GMT -5
Ebola virus sp. Taxonomy ID: 205488 Inherited blast name: viruses Rank: speciesGenetic code: Translation table 1 (Standard) Host: vertebrates| human Other names: synonym: unidentified Ebola virus synonym: Ebola virus EBO synonym: Ebola virus Lineage( full ) Viruses; ssRNA viruses; ssRNA negative-strand viruses; Mononegavirales; Filoviridae; Ebolavirus; unclassified Ebolavirus Entrez records Database name Direct links Nucleotide 95 Protein 15 Structure 5 PubMed Central 2,106 Probe 10 Taxonomy 1 ICTV homepage External Information Resources (NCBI LinkOut) LinkOut Subject LinkOut ProviderEbo taxonomy/phylogenetic Encyclopedia of life Related Immune Epitope Information gene/protein/disease-specific Immune Epitope Database and Analysis Resource www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=205488============= On this table notice Code 2 and Standard Code in these Aminos:
KRITTERS~! The Initiation code is for Candida~! Initiation Codon: AUG
Alternative Initiation Codons In rare cases, translation in eukaryotes can be initiated from codons other than AUG. A well documented case (including direct protein sequencing) is the GUG start of a ribosomal P protein of the fungus Candida albicans (Abramczyk et al.) and the GUG initiation in mammalian NAT1 (Takahashi et al. 2005). Other examples can be found in the following references: Peabody 1989; Prats et al. 1989; Hann et al. 1992; Sugihara et al. 1990. The standard code currently allows initiation from UUG and CUG in addition to AUG.
2. The Vertebrate Mitochondrial Code (transl_table=2)
AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSS**VVVVAAAADDEEGGGG Starts = --------------------------------MMMM---------------M------------ Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Differences from the Standard Code: Code 2 Standard AGA Ter * Arg R AGG Ter * Arg R AUA Met M Ile I UGA Trp W Ter * Alternative Initiation Codon: Bos: AUA Homo: AUA, AUU Mus: AUA, AUU, AUC Coturnix, Gallus: also GUG (Desjardins and Morais, 1991) Systematic Range: Vertebratawww.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=cgencodes#SG1
|
|
|
Post by skyship on Jun 25, 2013 17:25:25 GMT -5
So, it is possible that the ribonucleotide if the P protein from Candida. And this could be the fusion protein in the Artificial Alpha Protein. Not sure, but if this is an initiation code and can go into the GUG of mammals or humans. Then this would be the initiation amino acid.
...."A well documented case (including direct protein sequencing) is the GUG start of a ribosomal P protein of the fungus Candida albicans (Abramczyk et al.) and the GUG initiation in mammalian NAT1 (Takahashi et al. 2005). Other examples can be found in the following references: Peabody 1989; Prats et al. 1989; Hann et al. 1992; Sugihara et al. 1990. The standard code currently allows initiation from UUG and CUG in addition to AUG.".......
ribosomal P protein of the fungus Candida albicans (Abramczyk et al.
So, if we examine some of these reports we may find the initial seed/pod/spore etc.
|
|
|
Post by kammy4 on Jul 8, 2013 9:49:45 GMT -5
Sky! Sky! yes, yes... just glancing at your posts. I am not in a position to do any deep research, at this point all I can do is report what's happening to me physically and what actions have been taken and what the results are.
I asked that the thread on 'what in the world do we personally think this disease is about?' be revived, (*sigh) so in the meantime, I will just post here on Kritzzy's random thoughts because that's what they are. I can't put 2 and 2 together, lord knows we have tried, and we end up chasing our tails around in a circle like a rabid dog... any ole who...
" it is possible that the ribonucleotide if the P protein from Candida."
First of all, Candida must be one of the main culprits, the reason I say that is long and detailed. I don't want to go into personal details here but yes, yes. Also, this is something 'natural' that is found in the human body that is not normally tested for, looked for, etc.
In a nutshell - overabundance growth of 'normal' flora/candida, overabundance growth of cells multiplying, overabundance of skin cells multiplying in those that are showing lesions/skin conditions.
That through possibly, (one of many) Vitamin D deficiency setting up the stage for a Rocky Horror Picture Show. Vit D deficiency further sets up imbalance in the Calcium/Magnesium ratios that are present in modern food/animal products. The lesions (disease?) is an out-of-control calcification process (partially?) cycled by too low Magnesium, too high Calcium intake.
There are 7 kinds of 'stones' that the kidneys can produce, as with kidney stones. (I don't know what they are or their characteristics, if someone wants to look?) That in some?/all? of us, with more extreme cases show this, we are producing lesion scab/scaling material that is akin to 'crystals'. In fact we have studied crystals quite a bit without being able to finger much. What we need to be looking at is what 'stones' the body produces. How to break up these stones, etc.
I am currently using a product on my skin that is a synthetic Vitamin D3, that seems to go down into the skin to dissolve what we have described as 'teeth' particulate matter that digs into the skin and is almost impossible to get out. This product is available through GP's and Dermatologists, it contains tacalcitol, call Curatoderm in salve or ointment (petroleum base). It slows down the cells multiplying process. (This information is for all the gals that were having face problems (before I had lesions) and were picking daily, etc.)
Also, for a re-occurring UTI from hail, I am starting to suspect that stones might be involved, the kidneys would have to be checked next. I am drinking a stinging nettle tea, (thanks to Katinka looking these products up for me) which should help with breaking of the stone material and many other benefits, please look it up. The pharmacist mentioned that in the case of a UTI that won't go away that stones could be involved. This set off a light bulb when he said - 'the microbe incorporates itself inside the stone and you can take unlimited amounts of antibiotics without effect because the microbe incorporates itself inside the stone material as a barrier for protection'. This is my 7th? round of antibiotics for the UTI, I now have obvious candida.
(Back to the dog chasing tail thing - I think the candida was there all along. I hope somebody can make some sense out of this circle I'm trying to convey?)
Off the top of my head, my personal disease seems to be a mixture of candida, multiple viruses, Vit D deficiency, Cal/Mag imbalance, stone material production, over abundance of skin cell growth... (kidney problems can produce fluid in the lungs (hence re-occurring pneumonia)).
Good to see that Mfromcanada is still trucking, you go girl! To our heroes and heroines, all of you >3!
|
|
|
Post by kammy4 on Jul 8, 2013 12:40:57 GMT -5
I just wanted to add that since I've been having a re-occurring UTI for 7 months now, Katinka went to look on the health forums and several women are reporting that every time they drink the tap water, their infection came back. That as long as they boiled the water for teas, cooking, etc., they were fine. It was not from any specific region, it was from several different regions. (I had been drinking mostly the tap water filtered with a B. pitcher filter. Some of the women on the forum speculated that the chemicals in the remediation process did not agree with them.)
Katinka says that 'MSM also breaks down calcification in the body and with a Vit. D deficiency the body does not deposit the calcium in the bones and teeth but rather in the cells which can cause tremendous health issues'...
|
|
|
Post by kammy4 on Jul 8, 2013 15:00:01 GMT -5
When one searches "MSM calcification": indigosociety.com/showthread.php?25947-Decalcification-Alchemical-Sulphur-(use-DMSO-or-MSM)Look at what this person from Australia has to say... "(a micro-organism the size of a virus) which has a shell like a snail (there is a little slug type creature inside the shell). Now these organisms live in colonies which form these coral like reefs in the bodies of any living organism." Holy cow! What the frack are they talking about?... where's the emoticons? (One of us got loose on another site, I thought us Morgies were the only ones talking this? LOL) One might want to check out what David Wolf is saying?
|
|
|
Post by skyship on Jul 9, 2013 4:17:01 GMT -5
Does the candida lysosome? This may indicate that the protozoan is leishmania. The reason I say this, is because the lysosomes contact the protozoan which is on outside of cell, It forms a circle and hardens, is made of calcium, in fact CA2 and it encases the protozoan inside this shell. Norma Andrews from Yale and her lab people had questions, as to how the protozoan could stay alive. Brings to mind Dr. Fry's conclusion on this, that a biofilm forms around the protozoan. This biofilm hardens like a stone, and we have the shards. Now she goes onto describe how a "vacuole forms around the parasite and it is made of lysosome compartment. the deeper it goes into the lysosome compartment, it mutates into the cell. It has to do with membrane fusion. Now, the candida would be part of the yeast. Something called the SNARE Complex. But the protozoan could look slug like, however it seems to be comfortable inside the calcified compartment, and does not die.
She also talks about iron and the Fe2 and Fe3 business, that Carnicom mentions, the radical would be the protozoan itself. The lab wonder what cell types are effected? Lesions heal, but the parasite persists. Chau Huynh wondered how it acquired the iron to survive? he said there are 8 transitional domains. I do believe it was mentioned many years ago, on BiologyonLine, on the Fiber Thread that there were 8 stages to this Morgellons.
The Amastigote stage of this protozoan. The acid would be in the membrane proteins.
The Australian makes sense.......
And........this involves the microtubules. So, I would surmise that this involves the "cytoskeletal cells" as we mentioned a while back. These cells may involve what she calls the "molecular motors".
So, here are her videos. I am thinking this is cross between leismaniasis protozoan and trypanasoma as was mentioned in "foreign adaptive proteins".
So, the name alone, may give us a clue: The SNARE COMPLEX. The lysosomes snare the protozoan, but only gives it a home, a shell, a calcified shell, but it does not die.
She is talking about the trypanasoma here, but notice at 3:02, she shows that "yeast" is involved. "Polymerized actin around phagosomes containing yeast particles".....
It is hard to understand the lysosomal process, but as you follow along, stay with it, you can see what she means and she then gets into the "leishmania Protozoan", and this could be what the Gulf War folks suffered from, very similar to trypanasoma, but yet is brought by sandfly, very common in Desert area. so? mmmmmmmmm makes one wonder? but, lets follow here at 20:31 she talks of "leishmania"
Leishmania acquires iron from the cell. This protozoan is very similar to the trypanasoma. I have seen these membranous forms. So, this LIT1A and LIT1B (leish iron tranporters.) This is a gene. Was this used in "homologous" or recombination work? or as a bioweapon? Kuwait comes to mind. www.youtube.com/watch?v=etRJ0ZS01JY---------------------------------------------- It appears that the lysosomes form the biofilm which holds the Leishmania protozoan, where it replicates, so when lesions look like they heal, there is replicating going on underneath the encasement.
|
|